PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do003140.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family TALE
Protein Properties Length: 600aa    MW: 64599 Da    PI: 7.9533
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do003140.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.75.3e-103734101954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yp+  +++ LAk++gLt +qV++WF N R +
  Do003140.1 373 FEHflHPYPTDGDKQMLAKQTGLTRNQVSNWFINARVR 410
                 554459******************************88 PP

2BELL93.91.5e-30239308372
        BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 +e q kk++L+s++eeV+krY+ y++q+qtv++sFe+vag  +a+p++++Al+a++rhF+cLk +i +q+
  Do003140.1 239 AEQQWKKTRLISMMEEVCKRYRLYYQQVQTVMNSFETVAGFSNAAPFVTMALRAMARHFKCLKGMILSQL 308
                 5899**************************************************************9996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.9E-36169306IPR006563POX domain
PfamPF075264.8E-36174304IPR006563POX domain
PROSITE profilePS5007112.293351414IPR001356Homeobox domain
SMARTSM003891.7E-10354418IPR001356Homeobox domain
CDDcd000862.68E-13354415No hitNo description
SuperFamilySSF466895.56E-17356422IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.7E-28357418IPR009057Homeodomain-like
PfamPF059206.4E-19371410IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 600 aa     Download sequence    Send to blast
MSSAAGGYGG GAGSGAEPHC HGHGHGEFLL HHHAQHVASA QQQQQQLYHV PQHSRREKLR  60
FPPDDSPPHA SASAPQHQHH AGAGWPPPPP AFYSYASSST SSYSPHSPTL AQAQLVVSHG  120
HGLATPLSSQ IPTQNFALSL SSSSSNPPPP QPRRPLGAPS GSGPFGPFTG YAAVLGRSRF  180
LAPAEKLLEE ICDVGGAARH VDRSASDEAL LDADPMEGID HDMDGADRAA SDAGPISGAE  240
QQWKKTRLIS MMEEVCKRYR LYYQQVQTVM NSFETVAGFS NAAPFVTMAL RAMARHFKCL  300
KGMILSQLRN TSKGAPGKEG LSKDIAMFGL ASGSAATLQR ASSVAAFGQP HNIWRPQRGL  360
PERSVSVLRA WLFEHFLHPY PTDGDKQMLA KQTGLTRNQV SNWFINARVR LWKPMVEEIH  420
NLEMRQVHKH PALDKSQHAM HHQTQHSSES SGKPSDPSDS QLGQSSSITR NHAIPASQGF  480
PDELSQMSHS IQQGQVTFAY NGLSTPQHQH SLASSQHHQQ VGSMSGIGGA GNGGVSLTLG  540
LHQNNRVCIT EPLPASLPTN LAHRFGLEEV SDAYVMGSFG GQDRHFGKEI GGHLVHDFVG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B2e-16360417158Homeobox protein Meis1
4xrs_A2e-16360417158Homeobox protein Meis1
3k2a_B2e-16360418563Homeobox protein Meis2
3k2a_A2e-16360418563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970574.10.0PREDICTED: BEL1-like homeodomain protein 9
TrEMBLK3XFT40.0K3XFT4_SETIT; Uncharacterized protein
STRINGSi000753m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25283881
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27990.12e-71BEL1-like homeodomain 8